PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10035275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 568aa    MW: 61698.9 Da    PI: 5.4329
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10035275genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-134390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++v++ G g+W+++ +  g+ R++k+c++rw ++l
      Lus10035275 43 KGPWTAAEDAILTEYVRRRGEGNWNSVQKNCGLMRCGKSCRLRWANHL 90
                     79******************************************9986 PP

2Myb_DNA-binding47.54.2e-1596139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+  +++++ ++G++ W++ a  ++ gRt++++k++w++
      Lus10035275  96 KGAFTPEEERVIIELHFKYGNK-WARMATQLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5483890IPR017930Myb domain
SuperFamilySSF466891.09E-2840137IPR009057Homeodomain-like
SMARTSM007172.5E-94292IPR001005SANT/Myb domain
PfamPF002494.0E-124390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-224497IPR009057Homeodomain-like
CDDcd001674.55E-84590No hitNo description
PROSITE profilePS5129424.94891145IPR017930Myb domain
SMARTSM007172.2E-1595143IPR001005SANT/Myb domain
PfamPF002495.8E-1496139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2598144IPR009057Homeodomain-like
CDDcd001673.13E-1198139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MMQNDVVEHD DESGGGGAAT MVVVAGGGGG GGQRKGNLQG LKKGPWTAAE DAILTEYVRR  60
RGEGNWNSVQ KNCGLMRCGK SCRLRWANHL RPNLKKGAFT PEEERVIIEL HFKYGNKWAR  120
MATQLPGRTD NEIKNYWNTR MKRRHRAGLP MYPREFLDQT ASFHMQQRQQ QEHNFIDHNN  180
NMKPSSSLFS VFCKATTPDY NPCDFSLSAD KLADFSSSAP GAGESYQGHN SHHNNLICST  240
NYHQHQQQQY INSQNGVVLA PLSLSPPVVS AFAPPQQLIV FGQSSASPAI DQLHGGGGGG  300
GGGGESYPNN VISFTSLIMG DYEDRNVDQL ESFSFASASE LPSLQTPPRS ASSNAATSCV  360
GRGVCITVEE PDNANCNSNS NNNGGEVVRD GNDEISHEDG VLIGGNMVIG DNNSGMLDVL  420
LQESKSIMCR KRKADDRDIS SPAGEDEGKR LCNPTMFRIA AGSNEQLASD GGWWDPRGNF  480
ISSLGHVGME LKEKAEVMAP EEMSSTTIVD DDDLLSLLAN FPSSVPLPEW YRGHHNNTTN  540
DDNNNNSNNV NDYQISGIGG GFNDHQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29411445107B-MYB
1h8a_C5e-294114425127MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-70myb domain protein 101